Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HMGA1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003159-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HMGA1 partial ORF ( NP_665906.1, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.51
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003159-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3159
  • Gene Name:
  • HMGA1
  • Gene Alias:
  • HMG-R,HMGA1A,HMGIY,MGC12816,MGC4242,MGC4854
  • Gene Description:
  • high mobility group AT-hook 1
  • Gene Summary:
  • This gene encodes a non-histone protein involved in many cellular processes, including regulation of inducible gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of A+T-rich regions in double-stranded DNA. It has little secondary structure in solution but assumes distinct conformations when bound to substrates such as DNA or other proteins. The encoded protein is frequently acetylated and is found in the nucleus. At least seven transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016222,OTTHUMP00000016223,OTTHUMP00000016224,OTTHUMP00000039618,high-mobility group (nonhistone chromosomal) protein isoforms I and Y,nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y
  • RSS
  • YouTube
  • Linkedin
  • Facebook