HMGA1 monoclonal antibody (M03), clone 2A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HMGA1.
Immunogen
HMGA1 (NP_665906.1, 1 a.a. ~ 107 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.51 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HMGA1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — HMGA1
Entrez GeneID
3159GeneBank Accession#
NM_145899Protein Accession#
NP_665906.1Gene Name
HMGA1
Gene Alias
HMG-R, HMGA1A, HMGIY, MGC12816, MGC4242, MGC4854
Gene Description
high mobility group AT-hook 1
Omim ID
600701Gene Ontology
HyperlinkGene Summary
This gene encodes a non-histone protein involved in many cellular processes, including regulation of inducible gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of A+T-rich regions in double-stranded DNA. It has little secondary structure in solution but assumes distinct conformations when bound to substrates such as DNA or other proteins. The encoded protein is frequently acetylated and is found in the nucleus. At least seven transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000016222|OTTHUMP00000016223|OTTHUMP00000016224|OTTHUMP00000039618|high-mobility group (nonhistone chromosomal) protein isoforms I and Y|nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y
-
Interactome
-
Disease
-
Publication Reference
-
Furospinosulin-1, marine spongean furanosesterterpene, suppresses the growth of hypoxia-adapted cancer cells by binding to transcriptional regulators p54nrb and LEDGF/p75.
Arai M, Kawachi T, Kotoku N, Nakata C, Kamada H, Tsunoda S, Tsutsumi Y, Endo H, Inoue M, Sato H, Kobayashi M.
ChemBioChem 2016 Jan; 17(2):181.
Application:WB-Ce, Human, DU145 cells.
-
Furospinosulin-1, marine spongean furanosesterterpene, suppresses the growth of hypoxia-adapted cancer cells by binding to transcriptional regulators p54nrb and LEDGF/p75.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com