Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HMGA1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00003159-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human HMGA1 protein.
  • Immunogen:
  • HMGA1 (AAH04924, 1 a.a. ~ 96 a.a) full-length human protein.
  • Sequence:
  • MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of HMGA1 expression in transfected 293T cell line (H00003159-T01) by HMGA1 MaxPab polyclonal antibody.

    Lane 1: HMGA1 transfected lysate(10.56 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3159
  • Gene Name:
  • HMGA1
  • Gene Alias:
  • HMG-R,HMGA1A,HMGIY,MGC12816,MGC4242,MGC4854
  • Gene Description:
  • high mobility group AT-hook 1
  • Gene Summary:
  • This gene encodes a non-histone protein involved in many cellular processes, including regulation of inducible gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of A+T-rich regions in double-stranded DNA. It has little secondary structure in solution but assumes distinct conformations when bound to substrates such as DNA or other proteins. The encoded protein is frequently acetylated and is found in the nucleus. At least seven transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016222,OTTHUMP00000016223,OTTHUMP00000016224,OTTHUMP00000039618,high-mobility group (nonhistone chromosomal) protein isoforms I and Y,nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y
  • RSS
  • YouTube
  • Linkedin
  • Facebook