HMGN1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HMGN1 full-length ORF ( AAH23984, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPKRKVSSTEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (79); Rat (79)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HMGN1
Entrez GeneID
3150GeneBank Accession#
BC023984Protein Accession#
AAH23984Gene Name
HMGN1
Gene Alias
FLJ27265, FLJ31471, HMG14, MGC104230, MGC117425
Gene Description
high-mobility group nucleosome binding domain 1
Omim ID
163920Gene Ontology
HyperlinkGene Summary
Chromosomal protein HMG14 and its close analog HMG17 (MIM 163910) bind to the inner side of the nucleosomal DNA, potentially altering the interaction between the DNA and the histone octamer. The 2 proteins may be involved in the process that maintains transcribable genes in a unique chromatin conformation. Their ubiquitous distribution and relative abundance, as well as the high evolutionary conservation of the DNA-binding domain of the HMG14 family of proteins, suggest that they may be involved in an important cellular function.[supplied by OMIM
Other Designations
OTTHUMP00000068966|high-mobility group (nonhistone chromosomal) protein 14|high-mobility group nucleosome binding 1|nonhistone chromosomal protein HMG-14
-
Interactome
-
Publication Reference
-
Serine ADP-Ribosylation Depends on HPF1.
Bonfiglio JJ, Fontana P, Zhang Q, Colby T, Gibbs-Seymour I, Atanassov I, Bartlett E Zaja R, Ahel I, Matic I.
Molecular Cell 2017 Mar; 65(5):932.
Application:Func, Recombinant protein.
-
Serum autoantibody signature of ductal carcinoma in situ progression to invasive breast cancer.
Mange A, Lacombe J, Bascoul Mollevi C, Jarlier M, Lamy PJ, Rouanet P, Maudelonde T, Solassol J.
Clinical Cancer Research 2012 Apr; 18(7):1992.
Application:ELISA, Func, Human, Human serum.
-
Serine ADP-Ribosylation Depends on HPF1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com