HMGB2 monoclonal antibody (M02), clone 4G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant HMGB2.
Immunogen
HMGB2 (AAH00903.2, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HMGB2 monoclonal antibody (M02), clone 4G7 Western Blot analysis of HMGB2 expression in K-562 ( Cat # L009V1 ).Western Blot (Cell lysate)
HMGB2 monoclonal antibody (M02), clone 4G7. Western Blot analysis of HMGB2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of HMGB2 expression in transfected 293T cell line by HMGB2 monoclonal antibody (M02), clone 4G7.
Lane 1: HMGB2 transfected lysate(22 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HMGB2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — HMGB2
Entrez GeneID
3148GeneBank Accession#
BC000903Protein Accession#
AAH00903.2Gene Name
HMGB2
Gene Alias
HMG2
Gene Description
high-mobility group box 2
Omim ID
163906Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq
Other Designations
high-mobility group (nonhistone chromosomal) protein 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com