Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HLCS polyclonal antibody (A01)

  • Catalog # : H00003141-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HLCS.
  • Immunogen:
  • HLCS (NP_000402, 627 a.a. ~ 724 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ELKPLRADYLIARVVTVLEKLIKEFQDKGPNSVLPLYYRYWVHSGQQVHLGSAEGPKVSIVGLDDSGFLQVHQEGGEVVTVHPDGNSFDMLRNLILPK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003141-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3141
  • Gene Name:
  • HLCS
  • Gene Alias:
  • HCS
  • Gene Description:
  • holocarboxylase synthetase (biotin-(proprionyl-Coenzyme A-carboxylase (ATP-hydrolysing)) ligase)
  • Gene Summary:
  • Holocarboxylase synthetase (EC 6.3.4.10) covalently links biotin to propionyl-CoA carboxylase (PCCA; MIM 232000), pyruvate carboxylase (PC; MIM 608786), alpha-methylcrotonyl-CoA carboxylase (MCCC1; MIM 609010), and acetyl-CoA carboxylase (ACACA; MIM 200350).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000109039,biotin apo-protein ligase,holocarboxylase synthetase
  • RSS
  • YouTube
  • Linkedin
  • Facebook