HLA-G (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HLA-G full-length ORF (1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPHGRPGYSRVSGSGIHPEAAGPAQTLYLGEPQAPLPKSLRVGPGEGEARWAGLTEGVGPGSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
57.6
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HLA-G
Entrez GeneID
3135GeneBank Accession#
AK093478.1Gene Name
HLA-G
Gene Alias
MHC-G
Gene Description
major histocompatibility complex, class I, G
Gene Ontology
HyperlinkGene Summary
HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail. [provided by RefSeq
Other Designations
HLA class I molecule|HLA-G histocompatibility antigen, class I, G|MHC class I antigen|OTTHUMP00000039485|b2 microglobulin
-
Interactome
-
Pathway
-
Disease
- Abortion
- Anemia
- Arthritis
- Asthma
- Autoimmune Diseases
- Behcet Syndrome
- Birth Weight
- Bronchial Hyperreactivity
- Carcinoma
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com