HLF monoclonal antibody (M04), clone M2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant HLF.
Immunogen
HLF (AAH36093, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (58.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HLF expression in transfected 293T cell line by HLF monoclonal antibody (M04), clone M2.
Lane 1: HLF transfected lysate(33.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of HLF over-expressed 293 cell line, cotransfected with HLF Validated Chimera RNAi ( Cat # H00003131-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HLF monoclonal antibody (M04), clone M2 (Cat # H00003131-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to HLF on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — HLF
Entrez GeneID
3131GeneBank Accession#
BC036093Protein Accession#
AAH36093Gene Name
HLF
Gene Alias
MGC33822
Gene Description
hepatic leukemia factor
Omim ID
142385Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the proline and acidic-rich (PAR) protein family, a subset of the bZIP transcription factors. The encoded protein forms homodimers or heterodimers with other PAR family members and binds sequence-specific promoter elements to activate transcription. Chromosomal translocations fusing portions of this gene with the E2A gene cause a subset of childhood B-lineage acute lymphoid leukemias. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Other Designations
-
-
Interactome
-
Publication Reference
-
Circadian clock-controlled intestinal expression of the multidrug resistance gene mdr1a in mice.
Murakami Y, Higashi Y, Matsunaga N, Koyanagi S, Ohdo S.
Gastroenterology 2008 Aug; 135(5):1636.
Application:WB-Tr, Human, Mouse, Colon 26 cells, Mouse ileum.
-
Circadian clock-controlled intestinal expression of the multidrug resistance gene mdr1a in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com