HLA-DRB4 monoclonal antibody (M01), clone 4C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HLA-DRB4 monoclonal antibody (M01), clone 4C8. Western Blot analysis of HLA-DRB4 expression in human kidney.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HLA-DRB4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HLA-DRB4 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (51.81 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant HLA-DRB4.
Immunogen
HLA-DRB4 (AAH05312, 30 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GDTQPRFLEQAKCECRFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.81 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HLA-DRB4 monoclonal antibody (M01), clone 4C8. Western Blot analysis of HLA-DRB4 expression in human kidney.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HLA-DRB4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HLA-DRB4 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — HLA-DRB4
Entrez GeneID
3126GeneBank Accession#
BC005312Protein Accession#
AAH05312Gene Name
HLA-DRB4
Gene Alias
DRB4, HLA-DR4B
Gene Description
major histocompatibility complex, class II, DR beta 4
Gene Ontology
HyperlinkGene Summary
HLA-DRB4 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB4 is linked with allelic variants of DRB1, otherwise it is omitted. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. [provided by RefSeq
Other Designations
DRB1 transplantation antigen|HLA DRB1*1202|MHC HLA DR-beta chain|MHC class II HLA-DR-beta-7|MHC class II antigen HLA-DR-beta|MHC class II antigen HLA-DRB1|MHC class2 antigen|class II histocompatibility antigen HLA DR alpha, beta1-0307|human leucocyte anti
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com