Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HLA-DRB1 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00003123-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human HLA-DRB1 protein.
  • Immunogen:
  • HLA-DRB1 (AAH33827.1, 1 a.a. ~ 266 a.a) full-length human protein.
  • Sequence:
  • MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • HLA-DRB1 MaxPab polyclonal antibody. Western Blot analysis of HLA-DRB1 expression in human spleen.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of HLA-DRB1 expression in transfected 293T cell line (H00003123-T03) by HLA-DRB1 MaxPab polyclonal antibody.

    Lane 1: HLA-DRB1 transfected lysate(29.26 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3123
  • Gene Name:
  • HLA-DRB1
  • Gene Alias:
  • DRB1,FLJ76359,HLA-DR1B,HLA-DRB,HLA-DRB1*,SS1
  • Gene Description:
  • major histocompatibility complex, class II, DR beta 1
  • Gene Summary:
  • HLA-DRB1 belongs to the HLA class II beta chain paralogs. The class II molecule is a heterodimer consisting of an alpha (DRA) and a beta chain (DRB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa. It is encoded by 6 exons. Exon one encodes the leader peptide; exons 2 and 3 encode the two extracellular domains; exon 4 encodes the transmembrane domain; and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Hundreds of DRB1 alleles have been described and typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogs DRB3, DRB4 and DRB5. DRB1 is present in all individuals. Allelic variants of DRB1 are linked with either none or one of the genes DRB3, DRB4 and DRB5. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. [provided by RefSeq
  • Other Designations:
  • HLA class II antigen beta chain,HLA class II histocompatibility antigen, DR-1 beta chain,HLA-DR-beta 1,MHC class II HLA-DR beta 1 chain,MHC class II HLA-DR-beta cell surface glycoprotein,MHC class II antigen HLA-DR13,human leucocyte antigen DRB1,leucocyte
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook