Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HLA-DPB1 (Human) Recombinant Protein (P02)

  • Catalog # : H00003115-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HLA-DPB1 full-length ORF ( AAH07963, 30 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 50.93
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003115-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3115
  • Gene Name:
  • HLA-DPB1
  • Gene Alias:
  • DPB1,HLA-DP1B
  • Gene Description:
  • major histocompatibility complex, class II, DP beta 1
  • Gene Summary:
  • HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. [provided by RefSeq
  • Other Designations:
  • HLA DP14-beta chain,HLA-DP histocompatibility type, beta-1 subunit,MHC HLA DPB1,MHC class II HLA-DP-beta,MHC class II HLA-DP-beta-1,MHC class II HLA-DRB1,MHC class II antigen DP beta 1 chain,MHC class II antigen DPbeta1,MHC class II antigen beta chain,OTT
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook