HLA-DMB purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HLA-DMB protein.
Immunogen
HLA-DMB (NP_002109.1, 1 a.a. ~ 263 a.a) full-length human protein.
Sequence
MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HLA-DMB expression in transfected 293T cell line (H00003109-T03) by HLA-DMB MaxPab polyclonal antibody.
Lane 1: HLA-DMB transfected lysate(28.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HLA-DMB
Entrez GeneID
3109GeneBank Accession#
NM_002118Protein Accession#
NP_002109.1Gene Name
HLA-DMB
Gene Alias
D6S221E, RING7
Gene Description
major histocompatibility complex, class II, DM beta
Omim ID
142856Gene Ontology
HyperlinkGene Summary
HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq
Other Designations
MHC class II HLA-DMB|MHC class II antigen HLA-DM beta chain|OTTHUMP00000029257|class II histocompatibility antigen, M beta chain
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The non-classical major histocompatibility complex II protein SLA-DM is crucial for African swine fever virus replication.
Katrin Pannhorst, Jolene Carlson, Julia E Hölper, Finn Grey, John Kenneth Baillie, Dirk Höper, Elisabeth Wöhnke, Kati Franzke, Axel Karger, Walter Fuchs, Thomas C Mettenleiter.
Scientific Reports 2023 Aug; 13(1):10342.
Application:WB, Human, HEK-293 T cells.
-
The non-classical major histocompatibility complex II protein SLA-DM is crucial for African swine fever virus replication.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com