Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HIF1A (Human) Recombinant Protein (Q01)

  • Catalog # : H00003091-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HIF1A partial ORF ( NP_001521, 717 a.a. - 826 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003091-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3091
  • Gene Name:
  • HIF1A
  • Gene Alias:
  • HIF-1alpha,HIF1,HIF1-ALPHA,MOP1,PASD8,bHLHe78
  • Gene Description:
  • hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
  • Gene Summary:
  • Hypoxia-inducible factor-1 (HIF1) is a transcription factor found in mammalian cells cultured under reduced oxygen tension that plays an essential role in cellular and systemic homeostatic responses to hypoxia. HIF1 is a heterodimer composed of an alpha subunit and a beta subunit. The beta subunit has been identified as the aryl hydrocarbon receptor nuclear translocator (ARNT). This gene encodes the alpha subunit of HIF-1. Overexpression of a natural antisense transcript (aHIF) of this gene has been shown to be associated with nonpapillary renal carcinomas. Two alternative transcripts encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • ARNT interacting protein,hypoxia-inducible factor 1, alpha subunit,hypoxia-inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor),member of PAS superfamily 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook