HIF1A monoclonal antibody (M02), clone 1D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HIF1A.
Immunogen
HIF1A (NP_001521, 717 a.a. ~ 826 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HIF1A is approximately 0.3ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between HDAC2 and HIF1A. HeLa cells were stained with anti-HDAC2 rabbit purified polyclonal 1:1200 and anti-HIF1A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — HIF1A
Entrez GeneID
3091GeneBank Accession#
NM_001530Protein Accession#
NP_001521Gene Name
HIF1A
Gene Alias
HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78
Gene Description
hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Omim ID
603348Gene Ontology
HyperlinkGene Summary
Hypoxia-inducible factor-1 (HIF1) is a transcription factor found in mammalian cells cultured under reduced oxygen tension that plays an essential role in cellular and systemic homeostatic responses to hypoxia. HIF1 is a heterodimer composed of an alpha subunit and a beta subunit. The beta subunit has been identified as the aryl hydrocarbon receptor nuclear translocator (ARNT). This gene encodes the alpha subunit of HIF-1. Overexpression of a natural antisense transcript (aHIF) of this gene has been shown to be associated with nonpapillary renal carcinomas. Two alternative transcripts encoding different isoforms have been identified. [provided by RefSeq
Other Designations
ARNT interacting protein|hypoxia-inducible factor 1, alpha subunit|hypoxia-inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)|member of PAS superfamily 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com