Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HHEX monoclonal antibody (M12), clone 2C8

  • Catalog # : H00003087-M12
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant HHEX.
  • Immunogen:
  • HHEX (NP_002720, 133 a.a. ~ 237 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • PLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003087-M12
    Western Blot detection against Immunogen (37.55 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • HHEX monoclonal antibody (M12), clone 2C8 Western Blot analysis of HHEX expression in LNCaP ( Cat # L004V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of HHEX expression in transfected 293T cell line by HHEX monoclonal antibody (M12), clone 2C8.

    Lane 1: HHEX transfected lysate(30.02 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3087
  • Gene Name:
  • HHEX
  • Gene Alias:
  • HEX,HMPH,HOX11L-PEN,PRH,PRHX
  • Gene Description:
  • hematopoietically expressed homeobox
  • Gene Summary:
  • This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020100,homeobox, hematopoietically expressed,proline-rich homeodomain-containing transcription factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook