HFE monoclonal antibody (M01), clone 1G12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HFE.
Immunogen
HFE (NP_000401, 115 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (78)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HFE monoclonal antibody (M01), clone 1G12. Western Blot analysis of HFE expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of HFE expression in transfected 293T cell line by HFE monoclonal antibody (M01), clone 1G12.
Lane 1: HFE transfected lysate(40.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HFE is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HFE on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — HFE
Entrez GeneID
3077GeneBank Accession#
NM_000410Protein Accession#
NP_000401Gene Name
HFE
Gene Alias
HFE1, HH, HLA-H, MGC103790, dJ221C16.10.1
Gene Description
hemochromatosis
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined. [provided by RefSeq
Other Designations
MHC class I-like protein HFE|hemochromatosis protein|hereditary hemochromatosis protein HLA-H
-
Interactome
-
Disease
-
Publication Reference
-
Hemochromatosis Enhances Tumor Progression via Upregulation of Intracellular Iron in Head and Neck Cancer.
Lenarduzzi M, Hui AB, Yue S, Ito E, Shi W, Williams J, Bruce J, Sakemura-Nakatsugawa N, Xu W, Schimmer A, Liu FF.
PLoS One 2013 Aug; 8(8):e74075.
Application:WB-Tr, Human, FaDu cells.
-
Hemochromatosis Enhances Tumor Progression via Upregulation of Intracellular Iron in Head and Neck Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com