HDGF (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HDGF partial ORF ( NP_004485, 184 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
TLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHESL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.01
Interspecies Antigen Sequence
Mouse (65); Rat (65)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HDGF
Entrez GeneID
3068GeneBank Accession#
NM_004494Protein Accession#
NP_004485Gene Name
HDGF
Gene Alias
DKFZp686J1764, FLJ96580, HMG1L2
Gene Description
hepatoma-derived growth factor (high-mobility group protein 1-like)
Omim ID
600339Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. This gene was thought initially to be located on chromosome X, however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000038721|hepatoma-derived growth factor
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com