Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HDGF polyclonal antibody (A01)

  • Catalog # : H00003068-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HDGF.
  • Immunogen:
  • HDGF (NP_004485, 184 a.a. ~ 240 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHESL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003068-A01
    Western Blot detection against Immunogen (32.38 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3068
  • Gene Name:
  • HDGF
  • Gene Alias:
  • DKFZp686J1764,FLJ96580,HMG1L2
  • Gene Description:
  • hepatoma-derived growth factor (high-mobility group protein 1-like)
  • Gene Summary:
  • This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. This gene was thought initially to be located on chromosome X, however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000038721,hepatoma-derived growth factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook