Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HCFC1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003054-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HCFC1 partial ORF ( NP_005325.1, 568 a.a. - 654 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGTILKLVTSADGKPTTIITTTQASGAGTKPTIL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.31
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003054-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3054
  • Gene Name:
  • HCFC1
  • Gene Alias:
  • CFF,HCF-1,HCF1,HFC1,MGC70925,VCAF
  • Gene Description:
  • host cell factor C1 (VP16-accessory protein)
  • Gene Summary:
  • This gene is a member of the host cell factor family and encodes a protein with five Kelch repeats, a fibronectin-like motif, and six HCF repeats, each of which contains a highly specific cleavage signal. This nuclear coactivator is proteolytically cleaved at one of the six possible sites, resulting in the creation of an N-terminal chain and the corresponding C-terminal chain. The final form of this protein consists of noncovalently bound N- and C-terminal chains. The protein is involved in control of the cell cycle and transcriptional regulation during herpes simplex virus infection. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
  • Other Designations:
  • host cell factor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook