HBZ monoclonal antibody (M03), clone 1G10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant HBZ.
Immunogen
HBZ (NP_005323, 1 a.a. ~ 81 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGAL
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.91 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HBZ expression in transfected 293T cell line by HBZ monoclonal antibody (M03), clone 1G10.
Lane 1: HBZ transfected lysate(15.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HBZ on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HBZ is approximately 10ng/ml as a capture antibody.ELISA
-
Gene Info — HBZ
Entrez GeneID
3050GeneBank Accession#
NM_005332Protein Accession#
NP_005323Gene Name
HBZ
Gene Alias
-
Gene Description
hemoglobin, zeta
Omim ID
142310Gene Ontology
HyperlinkGene Summary
Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'. [provided by RefSeq
Other Designations
zeta globin
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com