HBZ purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HBZ protein.
Immunogen
HBZ (NP_005323.1, 1 a.a. ~ 142 a.a) full-length human protein.
Sequence
MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HBZ MaxPab rabbit polyclonal antibody. Western Blot analysis of HBZ expression in mouse lung.Western Blot (Transfected lysate)
Western Blot analysis of HBZ expression in transfected 293T cell line (H00003050-T01) by HBZ MaxPab polyclonal antibody.
Lane 1: HBZ transfected lysate(15.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HBZ
Entrez GeneID
3050GeneBank Accession#
NM_005332.2Protein Accession#
NP_005323.1Gene Name
HBZ
Gene Alias
-
Gene Description
hemoglobin, zeta
Omim ID
142310Gene Ontology
HyperlinkGene Summary
Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'. [provided by RefSeq
Other Designations
zeta globin
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com