Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HBG1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003047-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HBG1 partial ORF ( NP_000550, 44 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.67
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003047-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3047
  • Gene Name:
  • HBG1
  • Gene Alias:
  • HBGA,HBGR,HSGGL1,PRO2979
  • Gene Description:
  • hemoglobin, gamma A
  • Gene Summary:
  • The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. [provided by RefSeq
  • Other Designations:
  • A-gamma globin,gamma A hemoglobin,gamma globin,hemoglobin gamma-a chain,hemoglobin, gamma, regulator of
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook