HBB (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HBB partial ORF ( AAH07075, 38 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HBB
Entrez GeneID
3043GeneBank Accession#
BC007075Protein Accession#
AAH07075Gene Name
HBB
Gene Alias
CD113t-C
Gene Description
hemoglobin, beta
Gene Ontology
HyperlinkGene Summary
The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. [provided by RefSeq
Other Designations
beta globin|beta globin chain|hemoglobin beta chain
-
Interactome
-
Disease
-
Publication Reference
-
Hemoglobin subunit beta protein as a novel marker for time since deposition of bloodstains at crime scenes.
Tae Moo Heo, Sun-Yeong Gwon, Jung-Hyeon Yang, Sung Hee Hyun, Hee-Gyoo Kang, Ho Joong Sung.
Forensic Science International 2022 Jul; 336:111348.
Application:Quant.
-
Hemoglobin subunit beta protein as a novel marker for time since deposition of bloodstains at crime scenes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com