HBB monoclonal antibody (M02), clone 7B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HBB.
Immunogen
HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HBB on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HBB is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — HBB
Entrez GeneID
3043GeneBank Accession#
BC007075Protein Accession#
AAH07075Gene Name
HBB
Gene Alias
CD113t-C
Gene Description
hemoglobin, beta
Gene Ontology
HyperlinkGene Summary
The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. [provided by RefSeq
Other Designations
beta globin|beta globin chain|hemoglobin beta chain
-
Interactome
-
Disease
-
Publication Reference
-
Treatment of β654 -thalassaemia by TALENs in a mouse model.
Fang Y, Cheng Y, Lu D, Gong X, Yang G, Gong Z, Zhu Y, Sang X, Fan S, Zhang J, Zeng F.
Cell proliferation 2018 Dec; 51(6):e12491.
Application:WB, Mouse, Mouse blood.
-
A Synthetic Model of Human Beta-Thalassemia Erythropoiesis Using CD34+ Cells from Healthy Adult Donors.
Lee YT, Kim KS, Byrnes C, de Vasconcellos JF, Noh SJ, Rabel A, Meier ER, Miller JL.
PLoS One 2013 Jul; 8(7):e68307.
Application:WB, Human, CD34+ cells.
-
Hemoglobin alpha and beta are ubiquitous in the human lung, decline in idiopathic pulmonary fibrosis but not in COPD.
Ishikawa N, Ohlmeier S, Salmenkivi K, Myllarniemi M, Rahman I, Mazur W, Kinnula VL.
Respiratory Research 2010 Sep; 11:123.
Application:WB-Ti, Human, Human lungs.
-
Treatment of β654 -thalassaemia by TALENs in a mouse model.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com