HBB monoclonal antibody (M01), clone 2H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HBB.
Immunogen
HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH
Host
Mouse
Reactivity
Human
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HBB is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — HBB
Entrez GeneID
3043GeneBank Accession#
BC007075Protein Accession#
AAH07075Gene Name
HBB
Gene Alias
CD113t-C
Gene Description
hemoglobin, beta
Gene Ontology
HyperlinkGene Summary
The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. [provided by RefSeq
Other Designations
beta globin|beta globin chain|hemoglobin beta chain
-
Interactome
-
Disease
-
Publication Reference
-
A novel transgenic mouse model produced from lentiviral germline integration for the study of beta-thalassemia gene therapy.
Li W, Xie S, Guo X, Gong X, Wang S, Lin D, Zhang J, Ren Z, Huang S, Zeng F, Zeng Y.
Haematologica 2008 Feb; 93(3):356.
Application:WB, Mouse, Fresh peripheral blood from transgenic mouse tail vein.
-
Restoration of the balanced {alpha}/{beta}-globin gene expression in {beta}654-thalassemia mice using combined RNAi and antisense RNA approach.
Xie SY, Ren ZR, Zhang JZ, Guo XB, Wang QX, Wang S, Lin D, Gong XL, Li W, Huang SZ, Zeng F, Zeng YT.
Human Molecular Genetics 2007 Aug; 16(21):2616.
Application:WB, Human, Fresh periphreral blood from transgenic mouse tail vein.
-
A novel transgenic mouse model produced from lentiviral germline integration for the study of beta-thalassemia gene therapy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com