HBA1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HBA1 partial ORF ( NP_000549, 33 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HBA1
Entrez GeneID
3039GeneBank Accession#
NM_000558Protein Accession#
NP_000549Gene Name
HBA1
Gene Alias
HBH, HBA-T3
Gene Description
hemoglobin, alpha 1
Omim ID
141800Gene Ontology
HyperlinkGene Summary
The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported. [provided by RefSeq
Other Designations
alpha 1 globin|alpha one globin|alpha-1 globin|alpha-1-globin|hemoglobin alpha 1 globin chain|hemoglobin alpha-1 chain
-
Interactome
-
Disease
-
Publication Reference
-
Method for diagnosing a hemoglobin-related disorder.
Veronique Baudin-Creuza, Corinne Vasseur, Frederic Galacteros.
United States Patent Application Publication 2015 Oct; [Epub].
Application:C-ELISA, Recombinant protein.
-
Method for diagnosing a hemoglobin-related disorder.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com