HAS3 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of HAS3 expression in transfected 293T cell line (H00003038-T01) by HAS3 MaxPab polyclonal antibody.
Lane 1: HAS3 transfected lysate(31.02 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HAS3 protein.
Immunogen
HAS3 (AAH21853, 1 a.a. ~ 281 a.a) full-length human protein.
Sequence
MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HAS3 expression in transfected 293T cell line (H00003038-T01) by HAS3 MaxPab polyclonal antibody.
Lane 1: HAS3 transfected lysate(31.02 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HAS3
Entrez GeneID
3038GeneBank Accession#
BC021853Protein Accession#
AAH21853Gene Name
HAS3
Gene Alias
-
Gene Description
hyaluronan synthase 3
Omim ID
602428Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. This gene is a member of the NODC/HAS gene family. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
HA synthase 3|OTTHUMP00000174869|hyaluronic acid synthase 3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com