HARS monoclonal antibody (M03), clone 4D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HARS.
Immunogen
HARS (NP_002100, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPV
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HARS monoclonal antibody (M03), clone 4D4. Western Blot analysis of HARS expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
HARS monoclonal antibody (M03), clone 4D4. Western Blot analysis of HARS expression in IMR-32.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HARS is approximately 0.3ng/ml as a capture antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HARS is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — HARS
Entrez GeneID
3035GeneBank Accession#
NM_002109Protein Accession#
NP_002100Gene Name
HARS
Gene Alias
FLJ20491, HRS
Gene Description
histidyl-tRNA synthetase
Omim ID
142810Gene Ontology
HyperlinkGene Summary
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a cytoplasmic enzyme which belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. The gene is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis/dermatomyositis. [provided by RefSeq
Other Designations
HisRS|histidine tRNA ligase 1, cytoplasmic|histidine translase|histidine-tRNA ligase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com