HARS polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant HARS.
Immunogen
HARS (NP_002100, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag.
Sequence
MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.67 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — HARS
Entrez GeneID
3035GeneBank Accession#
NM_002109Protein Accession#
NP_002100Gene Name
HARS
Gene Alias
FLJ20491, HRS
Gene Description
histidyl-tRNA synthetase
Omim ID
142810Gene Ontology
HyperlinkGene Summary
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a cytoplasmic enzyme which belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. The gene is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis/dermatomyositis. [provided by RefSeq
Other Designations
HisRS|histidine tRNA ligase 1, cytoplasmic|histidine translase|histidine-tRNA ligase
-
Interactome
-
Pathway
-
Publication Reference
-
New mortalin and histidyl tRNA synthetase isoforms point out a pitfall in proteomic analysis of Egr1 genetically modified mice.
Chardonnet S, Decottignies P, Amar L, Le Caer JP, Davis S, Laroche S, Le Marechal P.
Proteomics 2007 Jan; 7(2):289.
Application:WB, Mouse, Mouse cortex.
-
New mortalin and histidyl tRNA synthetase isoforms point out a pitfall in proteomic analysis of Egr1 genetically modified mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com