HAL monoclonal antibody (M04), clone 4F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HAL.
Immunogen
HAL (NP_002099, 558 a.a. ~ 657 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKIPESEDL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HAL expression in transfected 293T cell line by HAL monoclonal antibody (M04), clone 4F2.
Lane 1: HAL transfected lysate(72.698 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of HAL transfected lysate using anti-HAL monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HAL MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — HAL
Entrez GeneID
3034GeneBank Accession#
NM_002108Protein Accession#
NP_002099Gene Name
HAL
Gene Alias
HIS, HSTD
Gene Description
histidine ammonia-lyase
Gene Ontology
HyperlinkGene Summary
Histidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids [provided by RefSeq
Other Designations
histidase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Moderate UV Exposure Enhances Learning and Memory by Promoting a Novel Glutamate Biosynthetic Pathway in the Brain.
Zhu H, Wang N, Yao L, Chen Q, Zhang R, Qian J, Hou Y, Guo W, Fan S, Liu S, Zhao Q, Du F, Zuo X, Guo Y, Xu Y, Li J, Xue T, Zhong K, Song X, Huang G, Xiong W.
Cell 2018 Jun; 173(7):1716.
Application:WB, WB-Tr, Human, Mouse, Brain, HEK293, HEK293-Ctrl-si cells.
-
Increased Sensitivity of Histidinemic Mice to UVB Radiation Suggests a Crucial Role of Endogenous Urocanic Acid in Photoprotection.
Barresi C, Stremnitzer C, Mlitz V, Kezic S, Kammeyer A, Ghannadan M, Posa-Markaryan K, Selden C, Tschachler E, Eckhart L.
The Journal of Investigative Dermatology 2011 Jan; 131(1):188.
Application:IF, IHC-P, Human, Mouse, Epidermis, Skin specimens.
-
Histidase expression in human epidermal keratinocytes: Regulation by differentiation status and all-trans retinoic acid.
Eckhart L, Schmidt M, Mildner M, Mlitz V, Abtin A, Ballaun C, Fischer H, Mrass P, Tschachler E.
Journal of Dermatological Science 2008 Feb; 50(3):209.
Application:WB, Human, Normal human epidermal keratinocytes.
-
Moderate UV Exposure Enhances Learning and Memory by Promoting a Novel Glutamate Biosynthetic Pathway in the Brain.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com