HADHSC monoclonal antibody (M01), clone 4B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HADHSC monoclonal antibody (M01), clone 4B5 Western Blot analysis of HADHSC expression in HepG2 ( Cat # L019V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of HADH expression in transfected 293T cell line by HADHSC monoclonal antibody (M01), clone 4B5.
Lane 1: HADH transfected lysate(34.3 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HADHSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of HADH transfected lysate using anti-HADH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HADH MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HADHSC is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to HADHSC on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HADHSC.
Immunogen
HADHSC (NP_005318, 205 a.a. ~ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (91)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HADHSC monoclonal antibody (M01), clone 4B5 Western Blot analysis of HADHSC expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of HADH expression in transfected 293T cell line by HADHSC monoclonal antibody (M01), clone 4B5.
Lane 1: HADH transfected lysate(34.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HADHSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of HADH transfected lysate using anti-HADH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HADH MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HADHSC is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HADHSC on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — HADH
Entrez GeneID
3033GeneBank Accession#
NM_005327Protein Accession#
NP_005318Gene Name
HADH
Gene Alias
HAD, HADH1, HADHSC, HHF4, M/SCHAD, MGC8392, SCHAD
Gene Description
hydroxyacyl-Coenzyme A dehydrogenase
Gene Ontology
HyperlinkGene Summary
This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene. [provided by RefSeq
Other Designations
L-3-hydroxyacyl-Coenzyme A dehydrogenase|L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Independent effects of endurance training and weight loss on peak fat oxidation in moderately overweight men: a randomized controlled trial.
Nordby P, Rosenkilde M, Ploug T, Westh K, Feigh M, Nielsen NB, Helge JW, Stallknecht B.
Journal of Applied Physiology (Bethesda, Md. : 1985) 2015 Apr; 8(7):803.
Application：WB-Ti, Human, Skeletal muscle.
-
Changes in peak fat oxidation in response to different doses of endurance training.
Rosenkilde M, Reichkendler MH, Auerbach P, Bonne TC, Sjodin A, Ploug T, Stallknecht BM.
Scandinavian Journal of Medicine & Science in Sports 2015 Feb; 25(1):41.
Application：WB, Human, Muscle.
-
BCAT1 promotes cell proliferation through amino acid catabolism in gliomas carrying wild-type IDH1.
Tonjes M, Barbus S, Park YJ, Wang W, Schlotter M, Lindroth AM, Pleier SV, Bai AH, Karra D, Piro RM, Felsberg J, Addington A, Lemke D, Weibrecht I, Hovestadt V, Rolli CG, Campos B, Turcan S, Sturm D, Witt H, Chan TA, Herold-Mende C, Kemkemer R, Konig R, Schmidt K, Hull WE, Pfister SM, Jugold M, Hutson SM, Plass C, Okun JG, Reifenberger G, Lichter P, Radlwimmer B.
Nature Medicine 2013 Jul; 19(7):901.
Application：WB-Tr, Human, U-87MG, U-373MG, Hs683 cells.
-
Independent effects of endurance training and weight loss on peak fat oxidation in moderately overweight men: a randomized controlled trial.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com