Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HABP2 monoclonal antibody (M01), clone 1H4

  • Catalog # : H00003026-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant HABP2.
  • Immunogen:
  • HABP2 (NP_004123, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • GNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of HABP2 transfected lysate using anti-HABP2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HABP2 MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged HABP2 is approximately 1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3026
  • Gene Name:
  • HABP2
  • Gene Alias:
  • FSAP,HABP,HGFAL,PHBP
  • Gene Description:
  • hyaluronan binding protein 2
  • Gene Summary:
  • The protein encoded by this gene is an extracellular serine protease that binds hyaluronic acid and is involved in cell adhesion. The encoded protein is synthesized as a single chain, but then undergoes an autoproteolytic event to form the functional heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This protease is known to cleave urinary plasminogen activator, coagulation factor VII, and the alpha and beta chains of fibrinogen, but not prothrombin, plasminogen, or the gamma chain of fibrinogen. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020505,factor VII activating protein,hepatocyte growth factor activator-like protein,hyaluronic acid binding protein 2,plasma hyaluronan binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook