Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HABP2 polyclonal antibody (A01)

  • Catalog # : H00003026-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HABP2.
  • Immunogen:
  • HABP2 (NP_004123, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003026-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3026
  • Gene Name:
  • HABP2
  • Gene Alias:
  • FSAP,HABP,HGFAL,PHBP
  • Gene Description:
  • hyaluronan binding protein 2
  • Gene Summary:
  • The protein encoded by this gene is an extracellular serine protease that binds hyaluronic acid and is involved in cell adhesion. The encoded protein is synthesized as a single chain, but then undergoes an autoproteolytic event to form the functional heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This protease is known to cleave urinary plasminogen activator, coagulation factor VII, and the alpha and beta chains of fibrinogen, but not prothrombin, plasminogen, or the gamma chain of fibrinogen. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020505,factor VII activating protein,hepatocyte growth factor activator-like protein,hyaluronic acid binding protein 2,plasma hyaluronan binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook