HIST1H1A purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HIST1H1A protein.
Immunogen
HIST1H1A (NP_005316.1, 1 a.a. ~ 215 a.a) full-length human protein.
Sequence
MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HIST1H1A expression in transfected 293T cell line (H00003024-T01) by HIST1H1A MaxPab polyclonal antibody.
Lane 1: HIST1H1A transfected lysate(21.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HIST1H1A
Entrez GeneID
3024GeneBank Accession#
NM_005325Protein Accession#
NP_005316.1Gene Name
HIST1H1A
Gene Alias
H1.1, H1F1, HIST1, MGC126642, MGC138345
Gene Description
histone cluster 1, H1a
Omim ID
142709Gene Ontology
HyperlinkGene Summary
Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq
Other Designations
H1 histone family, member 1|OTTHUMP00000018038|histone 1, H1a
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com