H3F3B polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (41.07 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant H3F3B.
Immunogen
H3F3B (AAH17558, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag.
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.07 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — H3F3B
Entrez GeneID
3021GeneBank Accession#
BC017558Protein Accession#
AAH17558Gene Name
H3F3B
Gene Alias
H3.3B, H3F3A
Gene Description
H3 histone, family 3B (H3.3B)
Omim ID
601058Gene Ontology
HyperlinkGene Summary
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is poyadenylated, unlike most histone genes. The protein encoded is a member of the histone H3 family. [provided by RefSeq
Other Designations
H3 histone, family 3A|H3 histone, family 3B
-
Interactome
-
Pathway
-
Publication Reference
-
Pioneer Factor-Nucleosome Binding Events during Differentiation Are Motif Encoded.
Meers MP, Janssens DH, Henikoff S.
Molecular Cell 2019 Aug; 75(3):562.
Application：Func, Human, K-562 cells.
-
Pioneer Factor-Nucleosome Binding Events during Differentiation Are Motif Encoded.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com