H2AFX purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of H2AFX expression in transfected 293T cell line (H00003014-T02) by H2AFX MaxPab polyclonal antibody.
Lane 1: H2AFX transfected lysate(15.10 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human H2AFX protein.
Immunogen
H2AFX (NP_002096.1, 1 a.a. ~ 143 a.a) full-length human protein.
Sequence
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of H2AFX expression in transfected 293T cell line (H00003014-T02) by H2AFX MaxPab polyclonal antibody.
Lane 1: H2AFX transfected lysate(15.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — H2AFX
Entrez GeneID
3014GeneBank Accession#
NM_002105.2Protein Accession#
NP_002096.1Gene Name
H2AFX
Gene Alias
H2A.X, H2A/X, H2AX
Gene Description
H2A histone family, member X
Omim ID
601772Gene Ontology
HyperlinkGene Summary
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. [provided by RefSeq
Other Designations
H2AX histone
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com