H1F0 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of H1F0 expression in transfected 293T cell line (H00003005-T01) by H1F0 MaxPab polyclonal antibody.
Lane 1: H1F0 transfected lysate(21.45 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human H1F0 protein.
Immunogen
H1F0 (AAH00145, 1 a.a. ~ 194 a.a) full-length human protein.
Sequence
MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of H1F0 expression in transfected 293T cell line (H00003005-T01) by H1F0 MaxPab polyclonal antibody.
Lane 1: H1F0 transfected lysate(21.45 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — H1F0
Entrez GeneID
3005GeneBank Accession#
BC000145Protein Accession#
AAH00145Gene Name
H1F0
Gene Alias
H10, H1FV, MGC5241
Gene Description
H1 histone family, member 0
Omim ID
142708Gene Ontology
HyperlinkGene Summary
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H1 family. [provided by RefSeq
Other Designations
H1.0, H1(0), H1-0|OTTHUMP00000028818
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com