GZMK MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GZMK expression in transfected 293T cell line (H00003003-T02) by GZMK MaxPab polyclonal antibody.
Lane 1: GZMK transfected lysate(29.04 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GZMK protein.
Immunogen
GZMK (NP_002095, 1 a.a. ~ 264 a.a) full-length human protein.
Sequence
MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (72)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GZMK expression in transfected 293T cell line (H00003003-T02) by GZMK MaxPab polyclonal antibody.
Lane 1: GZMK transfected lysate(29.04 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GZMK
Entrez GeneID
3003GeneBank Accession#
NM_002104Protein Accession#
NP_002095Gene Name
GZMK
Gene Alias
TRYP2
Gene Description
granzyme K (granzyme 3; tryptase II)
Omim ID
600784Gene Ontology
HyperlinkGene Summary
This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. [provided by RefSeq
Other Designations
granzyme 3|granzyme K|granzyme K (serine protease, granzyme 3; tryptase II)|tryptase II
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com