Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GZMB (Human) Recombinant Protein (Q01)

  • Catalog # : H00003002-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GZMB partial ORF ( AAH30195, 148 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003002-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3002
  • Gene Name:
  • GZMB
  • Gene Alias:
  • CCPI,CGL-1,CGL1,CSP-B,CSPB,CTLA1,CTSGL1,HLP,SECT
  • Gene Description:
  • granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1)
  • Gene Summary:
  • Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein encoded by this gene is crucial for the rapid induction of target cell apoptosis by CTL in cell-mediated immune response. [provided by RefSeq
  • Other Designations:
  • T-cell serine protease 1-3E,cathepsin G-like 1,cytotoxic serine protease B,fragmentin 2,granzyme B
  • RSS
  • YouTube
  • Linkedin
  • Facebook