GYPC purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GYPC expression in transfected 293T cell line (H00002995-T01) by GYPC MaxPab polyclonal antibody.
Lane 1: GYPC transfected lysate(14.08 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GYPC protein.
Immunogen
GYPC (NP_002092.1, 1 a.a. ~ 128 a.a) full-length human protein.
Sequence
MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (70)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GYPC expression in transfected 293T cell line (H00002995-T01) by GYPC MaxPab polyclonal antibody.
Lane 1: GYPC transfected lysate(14.08 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GYPC
Entrez GeneID
2995GeneBank Accession#
NM_002101.3Protein Accession#
NP_002092.1Gene Name
GYPC
Gene Alias
CD236, CD236R, GE, GPC, GYPD, MGC117309, MGC126191, MGC126192
Gene Description
glycophorin C (Gerbich blood group)
Gene Ontology
HyperlinkGene Summary
Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. [provided by RefSeq
Other Designations
glycophorin C
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com