Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GYPB (Human) Recombinant Protein (Q01)

  • Catalog # : H00002994-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GYPB partial ORF (NP_002091.2, 22 a.a. - 59 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • TTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 29.81
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00002994-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2994
  • Gene Name:
  • GYPB
  • Gene Alias:
  • CD235b,GPB,GPB.NY,GYPHe.NY,HGpMiVI,MNS,SS
  • Gene Description:
  • glycophorin B (MNS blood group)
  • Gene Summary:
  • Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. GYPB gene consists of 5 exons and has 97% sequence homology with GYPA from the 5' UTR to the coding sequence encoding the first 45 amino acids. In addition to the M or N and S or s antigens, that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta; also, Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. [provided by RefSeq
  • Other Designations:
  • Ss blood group,glycophorin B,glycophorin HeP2,glycophorin MiVI
  • RSS
  • YouTube
  • Linkedin
  • Facebook