Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GYPA (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00002993-H01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified GYPA (AAH13328.1 20 a.a. - 91 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293T cells
  • Sequence:
  • SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 10.67
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-GYPA plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    SDS-PAGE Gel
    QC Testing of H00002993-H01

    Western Blot
    QC Testing of H00002993-H01
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 2993
  • Gene Name:
  • GYPA
  • Gene Alias:
  • CD235a,GPA,GPErik,GPSAT,GpMiIII,HGpMiIII,HGpMiV,HGpMiX,HGpMiXI,HGpSta(C),MN,MNS
  • Gene Description:
  • glycophorin A (MNS blood group)
  • Gene Summary:
  • Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. [provided by RefSeq
  • Other Designations:
  • Mi.V glycoprotein (24 AA),erythroid-lineage-specific membrane sialoglycoprotein,glycophorin A,glycophorin A (MN blood group),glycophorin A MNS blood group,glycophorin A, GPA,glycophorin Erik,glycophorin MiI,glycophorin MiIII,glycophorin MiV,glycophorin Mi
  • RSS
  • YouTube
  • Linkedin
  • Facebook