Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GUCY2F (Human) Recombinant Protein (Q01)

  • Catalog # : H00002986-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GUCY2F partial ORF ( NP_001513, 311 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002986-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2986
  • Gene Name:
  • GUCY2F
  • Gene Alias:
  • CYGF,GC-F,GUC2DL,GUC2F,RETGC-2,ROS-GC2
  • Gene Description:
  • guanylate cyclase 2F, retinal
  • Gene Summary:
  • The protein encoded by this gene is a guanylyl cyclase found predominantly in photoreceptors in the retina. The encoded protein is thought to be involved in resynthesis of cGMP after light activation of the visual signal transduction cascade, allowing a return to the dark state. This protein is a single-pass type I membrane protein. Defects in this gene may be a cause of X-linked retinitis pigmentosa. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023839,guanylate cyclase 2D-like, membrane (retina-specific),guanylate cyclase 2F
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook