Product Browser

Last updated: 2017/11/12
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GUCY1A3 monoclonal antibody (M01), clone 2H1

  • Catalog # : H00002982-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant GUCY1A3.
  • Immunogen:
  • GUCY1A3 (AAH28384, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KATMPICQDIPEKNIQESLPQRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002982-M01
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged GUCY1A3 is approximately 1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2982
  • Gene Name:
  • GUCY1A3
  • Gene Alias:
  • GC-SA3,GUC1A3,GUCA3,GUCSA3,GUCY1A1
  • Gene Description:
  • guanylate cyclase 1, soluble, alpha 3
  • Gene Summary:
  • Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit, such as alpha-1 (GUCY1A3), and a beta subunit, typically beta-1 (GUCY1B3; MIM 139397), catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide and nitrovasodilator drugs (Zabel et al., 1998 [PubMed 9742212]).[supplied by OMIM
  • Other Designations:
  • GC-S-alpha-1,soluble guanylate cyclase large subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook