Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GUCA2B purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00002981-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human GUCA2B protein.
  • Immunogen:
  • GUCA2B (NP_009033.1, 1 a.a. ~ 112 a.a) full-length human protein.
  • Sequence:
  • MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GUCA2B expression in transfected 293T cell line (H00002981-T02) by GUCA2B MaxPab polyclonal antibody.

    Lane 1: GUCA2B transfected lysate(12.10 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2981
  • Gene Name:
  • GUCA2B
  • Gene Alias:
  • GCAP-II,UGN
  • Gene Description:
  • guanylate cyclase activator 2B (uroguanylin)
  • Gene Summary:
  • Uroguanylin and guanylin (GUCA2A; MIM 139392), peptide homologs of the bacterial heat-stable enterotoxins (e.g., the E. coli ST toxin; STa), are endogenous activators of the guanylate cyclase-2C receptor (GUCY2C; MIM 601330), which synthesizes cyclic GMP (cGMP), a key component of several intracellular signal transduction pathways.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000007927,uroguanylin
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook