BRF1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human BRF1 full-length ORF ( AAH16743, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTGRVCRGCGGTDIELDAARGDTVCTACGSVLEDNIIMSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYPVCRTEGTPHMLLDLSDLLQVDSLRPASFPTWGCDLGVVTRVVTGVYPRCLHASQWPVCAACPVRKFWSVG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
48.62
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — BRF1
Entrez GeneID
2972GeneBank Accession#
BC016743Protein Accession#
AAH16743Gene Name
BRF1
Gene Alias
BRF, FLJ42674, FLJ43034, GTF3B, MGC105048, TAF3B2, TAF3C, TAFIII90, TF3B90, TFIIIB90, hBRF
Gene Description
BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae)
Omim ID
604902Gene Ontology
HyperlinkGene Summary
This gene encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Two alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. Other transcript variants are possible, but their full-length natures have not been completely characterized. [provided by RefSeq
Other Designations
B - related factor 1|TATA box binding protein (TBP)-associated factor 3C|TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3B subunit 2|TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2|TBP - associated
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com