Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BRF1 (Human) Recombinant Protein (P01)

  • Catalog # : H00002972-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BRF1 full-length ORF ( AAH16743, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MTGRVCRGCGGTDIELDAARGDTVCTACGSVLEDNIIMSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYPVCRTEGTPHMLLDLSDLLQVDSLRPASFPTWGCDLGVVTRVVTGVYPRCLHASQWPVCAACPVRKFWSVG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48.62
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002972-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2972
  • Gene Name:
  • BRF1
  • Gene Alias:
  • BRF,FLJ42674,FLJ43034,GTF3B,MGC105048,TAF3B2,TAF3C,TAFIII90,TF3B90,TFIIIB90,hBRF
  • Gene Description:
  • BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae)
  • Gene Summary:
  • This gene encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Two alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. Other transcript variants are possible, but their full-length natures have not been completely characterized. [provided by RefSeq
  • Other Designations:
  • B - related factor 1,TATA box binding protein (TBP)-associated factor 3C,TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3B subunit 2,TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2,TBP - associated
  • RSS
  • YouTube
  • Linkedin
  • Facebook