BRF1 monoclonal antibody (M01), clone 2E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BRF1 is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (48.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant BRF1.
Immunogen
BRF1 (AAH16743, 1 a.a. ~ 208 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTGRVCRGCGGTDIELDAARGDTVCTACGSVLEDNIIMSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYPVCRTEGTPHMLLDLSDLLQVDSLRPASFPTWGCDLGVVTRVVTGVYPRCLHASQWPVCAACPVRKFWSVG
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (48.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BRF1 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — BRF1
Entrez GeneID
2972GeneBank Accession#
BC016743Protein Accession#
AAH16743Gene Name
BRF1
Gene Alias
BRF, FLJ42674, FLJ43034, GTF3B, MGC105048, TAF3B2, TAF3C, TAFIII90, TF3B90, TFIIIB90, hBRF
Gene Description
BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae)
Omim ID
604902Gene Ontology
HyperlinkGene Summary
This gene encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Two alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. Other transcript variants are possible, but their full-length natures have not been completely characterized. [provided by RefSeq
Other Designations
B - related factor 1|TATA box binding protein (TBP)-associated factor 3C|TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3B subunit 2|TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2|TBP - associated
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com