Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GSTZ1 (Human) Recombinant Protein (P01)

  • Catalog # : H00002954-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GSTZ1 full-length ORF ( AAH01453, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 49.50
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002954-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2954
  • Gene Name:
  • GSTZ1
  • Gene Alias:
  • GSTZ1-1,MAAI,MAI,MGC2029
  • Gene Description:
  • glutathione transferase zeta 1
  • Gene Summary:
  • This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq
  • Other Designations:
  • S-(hydroxyalkyl)glutathione lyase,glutathione S-alkyltransferase,glutathione S-aralkyltransferase,glutathione S-aryltransferase,glutathione s-transferase Zeta 1,maleylacetoacetate isomerase,maleylacetone isomerase
  • RSS
  • YouTube
  • Linkedin
  • Facebook