GSTZ1 monoclonal antibody (M01), clone 1G12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GSTZ1 monoclonal antibody (M01), clone 1G12 Western Blot analysis of GSTZ1 expression in HepG2 ( Cat # L019V1 ).
Western Blot (Cell lysate)
GSTZ1 monoclonal antibody (M01), clone 1G12. Western Blot analysis of GSTZ1 expression in PC-12(Cat # L012V1 ).
Western Blot (Cell lysate)
GSTZ1 monoclonal antibody (M01), clone 1G12. Western Blot analysis of GSTZ1 expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of GSTZ1 expression in transfected 293T cell line by GSTZ1 monoclonal antibody (M01), clone 1G12.
Lane 1: GSTZ1 transfected lysate (Predicted MW: 24.1 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of monoclonal antibody to GSTZ1 on HepG2 cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GSTZ1.
Immunogen
GSTZ1 (NP_665877, 109 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GSTZ1 monoclonal antibody (M01), clone 1G12 Western Blot analysis of GSTZ1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
GSTZ1 monoclonal antibody (M01), clone 1G12. Western Blot analysis of GSTZ1 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
GSTZ1 monoclonal antibody (M01), clone 1G12. Western Blot analysis of GSTZ1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of GSTZ1 expression in transfected 293T cell line by GSTZ1 monoclonal antibody (M01), clone 1G12.
Lane 1: GSTZ1 transfected lysate (Predicted MW: 24.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to GSTZ1 on HepG2 cell. [antibody concentration 10 ug/ml] -
Gene Info — GSTZ1
Entrez GeneID
2954GeneBank Accession#
NM_145870Protein Accession#
NP_665877Gene Name
GSTZ1
Gene Alias
GSTZ1-1, MAAI, MAI, MGC2029
Gene Description
glutathione transferase zeta 1
Omim ID
603758Gene Ontology
HyperlinkGene Summary
This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq
Other Designations
S-(hydroxyalkyl)glutathione lyase|glutathione S-alkyltransferase|glutathione S-aralkyltransferase|glutathione S-aryltransferase|glutathione s-transferase Zeta 1|maleylacetoacetate isomerase|maleylacetone isomerase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com