Product Browser

Last updated: 2017/9/17
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GSTZ1 polyclonal antibody (A01)

  • Catalog # : H00002954-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GSTZ1.
  • Immunogen:
  • GSTZ1 (NP_665877, 109 a.a. ~ 216 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002954-A01
    Western Blot detection against Immunogen (37.99 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2954
  • Gene Name:
  • GSTZ1
  • Gene Alias:
  • GSTZ1-1,MAAI,MAI,MGC2029
  • Gene Description:
  • glutathione transferase zeta 1
  • Gene Summary:
  • This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq
  • Other Designations:
  • S-(hydroxyalkyl)glutathione lyase,glutathione S-alkyltransferase,glutathione S-aralkyltransferase,glutathione S-aryltransferase,glutathione s-transferase Zeta 1,maleylacetoacetate isomerase,maleylacetone isomerase
  • RSS
  • YouTube
  • Linkedin
  • Facebook